PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.10040s0190.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family NAC
Protein Properties Length: 313aa    MW: 36138.6 Da    PI: 8.1023
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.10040s0190.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM44.93.6e-142313311128
                   NAM  11 deelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                           de +++ yL+  + + ++   e++k+vd+++ +P++L      +++   f + + +++a gk      +sg W+  g+dk ++sk +ge
  Bostr.10040s0190.1.p  23 DELIITGYLECMIVHGDFWP-EHLKDVDVFNKNPSELF-----DSQTPNFVVVKPRTEACGKTDG--CESGCWRIIGRDKLIKSKvTGE 103
                           5556789******9999877.78**************6.....3344567777777777765544..479**************99999 PP

                   NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                             g  k+L f k+++p+  k +Wvm+eyr+
  Bostr.10040s0190.1.p 104 ILGFNKILKFCKKKKPREYKRSWVMEEYRV 133
                           9***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100519.92113150IPR003441NAC domain
SuperFamilySSF1019416.8E-2322142IPR003441NAC domain
PfamPF023651.4E-623133IPR003441NAC domain
SuperFamilySSF1019413.53E-21153307IPR003441NAC domain
PROSITE profilePS5100514.123162309IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MVEYEVLVSD YKLIRNELIN GDDELIITGY LECMIVHGDF WPEHLKDVDV FNKNPSELFD  60
SQTPNFVVVK PRTEACGKTD GCESGCWRII GRDKLIKSKV TGEILGFNKI LKFCKKKKPR  120
EYKRSWVMEE YRVANNLNWK QDHLAKHFSY LSTRSPLPPN QLLPAYGVCF FDPEAEGASY  180
LRAIINYDGN SWPSYVTHNV YRLHPLTLVD PQDKKFKEYG TCIFANRTKT CGITDECDGG  240
CWRIIDVDCA IKLKTRKILG FRRVFKFSEN EGPTNVCEAK DVNETWTIEE YRLAKKVMQN  300
KVLCVIKKFP SD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_176234.11e-153NAC domain containing protein 23
TrEMBLO807511e-153O80751_ARATH; At1g60280
STRINGAT1G60280.11e-152(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37041459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G60280.11e-148NAC domain containing protein 23